Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR56 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN |
Rabbit Polyclonal Anti-GPR56 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR56 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human GPR56. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Chimpanzee, Elephant, Panda, Bovine, Pig (94%); Mouse, Rat, Hamster, Dog, Bat, Horse, Rabbit, Opossum (88%). |
Rabbit Polyclonal Anti-GPR56 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR56 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR56. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Pig (95%); Bovine, Rabbit (89%). |
ADGRG1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ADGRG1 |
ADGRG1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADGRG1. |
Active filters
Target Symbol
- ADGRG1