Rabbit Polyclonal Anti-ADHFE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADHFE1 antibody: synthetic peptide directed towards the middle region of human ADHFE1. Synthetic peptide located within the following region: RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS |
Anti-ADHFE1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 295-308 amino acids of human alcohol dehydrogenase, iron containing, 1 |
Anti-ADHFE1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 294-306 amino acids of human alcohol dehydrogenase, iron containing, 1 |
Germany
Japan
United Kingdom
China
