Rabbit Polyclonal Anti-ADPRHL2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ADPRHL2 |
Rabbit Polyclonal Anti-ADPRHL2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ADPRHL2 |
ARH3 (ADPRHL2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 93~123 amino acids from the N-terminal region of human ADPRHL2 |
Rabbit Polyclonal Anti-ADPRHL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADPRHL2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADPRHL2. Synthetic peptide located within the following region: SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV |