Antibodies

View as table Download

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Rabbit polyclonal anti-ADRB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB1 .

Goat Polyclonal Antibody against ADRB1

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence ESDEARRCYNDPK, from the internal region of the protein sequence according to NP_000675.1.

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

Anti-ADRB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Beta-1 adrenergic receptor

ADRB1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified