Antibodies

Jump to Filters
View as table Download
VG5Q (AGGF1) Rabbit Polyclonal Antibody
TA344936

USD 475.00

5 Days

Rabbit Polyclonal Anti-AGGF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGGF1 antibody: synthetic peptide directed towards the middle region of human AGGF1. Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
VG5Q (AGGF1) Rabbit Polyclonal Antibody
TA309567

USD 424.00

5 Days

Rabbit Polyclonal VG5Q Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to an epitope within residues 500-600 of the human VG5Q protein.
VG5Q (AGGF1) Rabbit Polyclonal Antibody
TA362120

USD 360.00

5 Days

AGGF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AGGF1