Rabbit Polyclonal Anti-AKAP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP5 antibody: synthetic peptide directed towards the middle region of human AKAP5. Synthetic peptide located within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE |
AKAP5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human AKAP5 (NP_004848.3). |
| Modifications | Unmodified |
AKAP5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human AKAP5 (NP_004848.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China