Antibodies

Jump to Filters
View as table Download
AKAP9 Rabbit Polyclonal Antibody
TA343561

USD 310.00

5 Days

Rabbit Polyclonal Anti-AKAP9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP9 antibody: synthetic peptide directed towards the N terminal of human AKAP9. Synthetic peptide located within the following region: MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS
AKAP9 Rabbit Polyclonal Antibody
TA322560

USD 345.00

In Stock

Anti-AKAP9 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein