AKIRIN2 rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | AKIRIN2 antibody was raised against akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2. |
AKIRIN2 rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | AKIRIN2 antibody was raised against akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2. |
Rabbit Polyclonal Akirin2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2. |
Rabbit Polyclonal Akirin2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2. |
Rabbit Polyclonal Anti-Akirin2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Akirin2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Akirin2. Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY |