Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Akirin2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2. |
Rabbit Polyclonal Akirin2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2. |
Rabbit Polyclonal Anti-Akirin2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Akirin2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Akirin2. Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY |
Active filters
Target Symbol
- AKIRIN2