Rabbit Polyclonal Anti-AKNA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKNA antibody is: synthetic peptide directed towards the C-terminal region of Human AKNA. Synthetic peptide located within the following region: SSTPSPKQRSKQAGSSPRPPPGLWYLATAPPAPAPPAFAYISSVPIMPYP |
Rabbit Polyclonal Anti-AKNA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKNA antibody is: synthetic peptide directed towards the C-terminal region of Human AKNA. Synthetic peptide located within the following region: AGGAVTGDPLGPPPADTLQCPLCGQVGSPPEADGPGSATSGAEKATTRRK |
Germany
Japan
United Kingdom
China