Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ANGPT2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG |
Rabbit Polyclonal Anti-ANG 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANG 2 Antibody: A synthesized peptide derived from human ANG 2 |
Rabbit polyclonal Angiopoietin 2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide, corresponding to a region near the N-terminus of mouse angiopoietin-2 protein, conjugated to KLH using maleimide. |
Carrier-free (BSA/glycerol-free) ANGPT2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-ANGPT2 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human angiopoietin 2 |
ANGPT2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ANGPT2 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ANGPT2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANGPT2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ANGPT2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ANGPT2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ANGPT2