Rabbit Polyclonal Anti-ANKS1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANKS1B antibody is: synthetic peptide directed towards the C-terminal region of Human ANKS1B. Synthetic peptide located within the following region: PSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETT |
Rabbit Polyclonal Anti-ANKS1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANKS1B antibody is: synthetic peptide directed towards the C-terminal region of Human ANKS1B. Synthetic peptide located within the following region: ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI |
ANKS1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 261-510 of human ANKS1B (NP_858056.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
