Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ANXA10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminalof human ANXA10. |
Antibodies
View as table Download
Goat Anti-Annexin A10 / Annexin 14 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence FCGDYVQGTIFPAPN, from the N Terminus of the protein sequence according to NP_009124.2. |
Rabbit anti-ANXA10 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-ANXA10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA10 antibody: synthetic peptide directed towards the middle region of human ANXA10. Synthetic peptide located within the following region: VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE |
ANXA10 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of Human ANXA10 |
ANXA10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-324 of human ANXA10 (NP_009124.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-ANXA10 (Annexin A10) mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- ANXA10