Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-Anxa13 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Anxa13 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK |
Rabbit Polyclonal Anti-ANXA13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS |
Rabbit Polyclonal Anti-ANXA13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE |
Anxa13 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Anxa13 |
ANXA13 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-316 of human ANXA13 (NP_004297.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ANXA13