Antibodies

Jump to Filters
View as table Download
Serum Amyloid P (APCS) Rabbit Polyclonal Antibody
TA346302

USD 410.00

5 Days

Rabbit Polyclonal Anti-APCS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APCS antibody: synthetic peptide directed towards the N terminal of human APCS. Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Serum Amyloid P (APCS) (C-term) Rabbit Polyclonal Antibody
AP50206PU-N

USD 450.00

2 Weeks

Serum Amyloid P (APCS) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 151-178 amino acids from the C-terminal region of Human APCS
Serum Amyloid P (APCS) Rabbit Polyclonal Antibody
TA327226

USD 345.00

3 Weeks

Rabbit anti-APCS Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human APCS
Serum Amyloid P (APCS) Rabbit Polyclonal Antibody
TA321386

USD 345.00

4 Weeks

Anti-APCS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Serum Amyloid P (APCS) Mouse Monoclonal Antibody [Clone ID: OTI1D6]
CF505247

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) APCS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Serum Amyloid P (APCS) Mouse Monoclonal Antibody [Clone ID: OTI1H2]
CF505248

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) APCS mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Serum Amyloid P (APCS) Mouse Monoclonal Antibody [Clone ID: OTI5A9]
CF505350

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) APCS mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated