Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ApoA4 Antibody
| Applications | WB |
| Reactivities | Chicken, Human |
| Conjugation | Unconjugated |
| Immunogen | ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4. |
Antibodies
View as table Download
Goat Polyclonal Antibody against APOA4
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-KEKESQDKTLSLP, from the internal region (near the C Terminus) of the protein sequence according to NP_000473.2. |
Rabbit Polyclonal ApoA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | ApoA4 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ApoA4. |
Rabbit Polyclonal Anti-APOA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-APOA4 Antibody: synthetic peptide directed towards the C terminal of human APOA4. Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ |
APOA4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse APOA4 |
APOA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2). |
| Modifications | Unmodified |
ApoA4 Mouse monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- APOA4