Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-APOBEC4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOBEC4. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-APOBEC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APOBEC4 Antibody: synthetic peptide directed towards the N terminal of human APOBEC4. Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL |
Rabbit Polyclonal Anti-APOBEC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APOBEC4 Antibody: synthetic peptide directed towards the middle region of human APOBEC4. Synthetic peptide located within the following region: VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK |
Carrier-free (BSA/glycerol-free) APOBEC4 mouse monoclonal antibody,clone OTI3F11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APOBEC4 mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
APOBEC4 mouse monoclonal antibody,clone OTI3F11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
APOBEC4 mouse monoclonal antibody,clone OTI3F11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
APOBEC4 mouse monoclonal antibody,clone OTI3F11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
APOBEC4 mouse monoclonal antibody,clone OTI3F11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
APOBEC4 mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
APOBEC4 mouse monoclonal antibody,clone OTI2C1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
APOBEC4 mouse monoclonal antibody,clone OTI2C1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
APOBEC4 mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- APOBEC4