Goat Polyclonal Antibody against SNX26
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SWSLHSEGQTRSYC, from the C Terminus of the protein sequence according to NP_443180.2. |
Goat Polyclonal Antibody against SNX26
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SWSLHSEGQTRSYC, from the C Terminus of the protein sequence according to NP_443180.2. |
Goat Polyclonal Antibody against SNX26 (N-terminal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ARSTDSLDGPGE-C, from the N Terminus of the protein sequence according to NP_443180.2. |
Rabbit Polyclonal Anti-ARHGAP33 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ARHGAP33 Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP33. Synthetic peptide located within the following region: PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW |