Antibodies

Jump to Filters
View as table Download
ARHGAP8 Rabbit Polyclonal Antibody
TA337735

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGAP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGAP8 antibody is: synthetic peptide directed towards the middle region of Human ARHGAP8. Synthetic peptide located within the following region: PRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRR