DRIL1 (ARID3A) mouse monoclonal antibody, clone 1A11, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
DRIL1 (ARID3A) mouse monoclonal antibody, clone 1A11, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-ARID3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARID3A Antibody: synthetic peptide directed towards the middle region of human ARID3A. Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG |
Rabbit Polyclonal Anti-ARID3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARID3A antibody: synthetic peptide directed towards the N terminal of human ARID3A. Synthetic peptide located within the following region: MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE |
ARID3A Rabbit polyclonal Antibody
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |