Antibodies

View as table Download

DRIL1 (ARID3A) mouse monoclonal antibody, clone 1A11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-ARID3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARID3A Antibody: synthetic peptide directed towards the middle region of human ARID3A. Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG

Rabbit Polyclonal Anti-ARID3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARID3A antibody: synthetic peptide directed towards the N terminal of human ARID3A. Synthetic peptide located within the following region: MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE

ARID3A Rabbit polyclonal Antibody

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified