Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ARID3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARID3A Antibody: synthetic peptide directed towards the middle region of human ARID3A. Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG |
Rabbit Polyclonal Anti-ARID3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARID3A antibody: synthetic peptide directed towards the N terminal of human ARID3A. Synthetic peptide located within the following region: MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE |
ARID3A Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-593 of human ARID3A (NP_005215.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ARID3A