Rabbit Polyclonal Anti-ARID5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARID5B antibody: synthetic peptide directed towards the C terminal of human ARID5B. Synthetic peptide located within the following region: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG |
Rabbit Polyclonal Anti-ARID5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARID5B antibody is: synthetic peptide directed towards the N-terminal region of Human ARID5B. Synthetic peptide located within the following region: FLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHA |
Germany
Japan
United Kingdom
China