Antibodies

Jump to Filters
View as table Download
ARMC5 Rabbit Polyclonal Antibody
TA330749

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARMC5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARMC5 antibody is: synthetic peptide directed towards the N-terminal region of Human ARMC5. Synthetic peptide located within the following region: GEAGEEEEEGREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDD