Rabbit polyclonal antibody to p21-ARC (actin related protein 2/3 complex, subunit 3, 21kDa)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Pig, Rhesus Monkey, Bovine) |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 178 of p21-ARC (Uniprot ID#O15145) |
p21 ARC (ARPC3) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ARPC3 |
Goat Polyclonal Antibody against ARPC3
| Applications | WB |
| Reactivities | Test: Human, Mouse. Expected from seq similarity: Human, Mouse, Rat, Dog, Cow |
| Immunogen | Peptide with sequence C-RQFMNKSLSGPGQ, from the C Terminus of the protein sequence according to NP_005710. |
Rabbit Polyclonal Anti-ARPC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the N terminal of human ARPC3. Synthetic peptide located within the following region: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK |
Rabbit Polyclonal Anti-ARPC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the middle region of human ARPC3. Synthetic peptide located within the following region: ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP |
ARPC3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human ARPC3 (NP_001265485.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
