Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ARRB1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This ARRB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-363 amino acids from the C-terminal region of human ARRB1. |
Rabbit polyclonal Arrestin 1 (Ser412) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Arrestin-1 around the phosphorylation site of serine 412 (T-G-SP-P-Q). |
| Modifications | Phospho-specific |
USD 380.00
4 Weeks
Mouse Monoclonal beta Arrestin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-ARRB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARRB1. |
Rabbit Polyclonal anti-ARRB1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB1 antibody: synthetic peptide directed towards the middle region of human ARRB1. Synthetic peptide located within the following region: NETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNN |
Carrier-free (BSA/glycerol-free) ARRB1 mouse monoclonal antibody, clone OTI3F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARRB1 mouse monoclonal antibody, clone OTI3G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ARRB1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARRB1 |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
ARRB1 mouse monoclonal antibody, clone OTI3F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
ARRB1 mouse monoclonal antibody, clone OTI3F10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
ARRB1 mouse monoclonal antibody, clone OTI3F10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ARRB1 mouse monoclonal antibody, clone OTI3F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ARRB1 mouse monoclonal antibody, clone OTI3G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
ARRB1 mouse monoclonal antibody, clone OTI3G9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
ARRB1 mouse monoclonal antibody, clone OTI3G9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ARRB1 mouse monoclonal antibody, clone OTI3G9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ARRB1