Antibodies

View as table Download

Rabbit Polyclonal Anti-Atf5 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atf5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Atf5. Synthetic peptide located within the following region: EGEALEGECQGLEARNRELRERAESVEREIQYVKDLLIEVYKARSQRTRS

Rabbit Polyclonal Anti-ATF5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF5 antibody: synthetic peptide directed towards the middle region of human ATF5. Synthetic peptide located within the following region: LPPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRK

ATF5 mouse monoclonal antibody, clone 4G5, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit polyclonal anti-ATF5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATF5.

Goat Anti-ATF5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVYKARSQRTRSC, from the C Terminus of the protein sequence according to NP_036200.2.

ATF5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 187-216 amino acids from the C-terminal region of human ATF5

Rabbit Polyclonal anti-ATF5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATF5 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF5. Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL

ATF5 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATF5.

ATF5 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ATF5

ATF5 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated