ATG16L1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ATG16L1 |
ATG16L1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ATG16L1 |
Rabbit anti-ATG16L1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal ATG16L Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATG16L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-190 amino acids from human ATG16L. |
ATG16L1 (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | ATG16L1 antibody was raised against 18 amino acid peptide from near the amino terminus of human ATG16 |
ATG16L1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | ATG16L1 antibody was raised against 18 amino acid peptide from near the center of human ATG16 |
Rabbit Polyclonal ATG16 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ATG16 antibody was raised against a 18 amino acid peptide from near the amino terminus of human ATG16. |
Rabbit Polyclonal ATG16 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ATG16 antibody was raised against a 18 amino acid peptide from near the center of human ATG16. |
Rabbit Polyclonal Anti-ATG16L1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the N terminal of human ATG16L1. Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ |
Goat Anti-ATG16L1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KVEKVLSKQHSSSIN, from the internal region (near the C Terminus) of the protein sequence according to NP_110430.5; NP_060444.3. |
Rabbit polyclonal anti-ATG16L1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ATG16L1. |
Rabbit Polyclonal Anti-ATG16L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the middle region of human ATG16L1. Synthetic peptide located within the following region: TSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPG |
Rabbit Polyclonal Anti-ATG16L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the middle region of human ATG16L1. Synthetic peptide located within the following region: RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA |
Rabbit Polyclonal ATG16L1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within residues 1-100 of human ATG16L1 protein. [Swiss-Prot# Q676U5] |
Rabbit Polyclonal ATG16L1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within residues 1-100 of mouse ATG16L1. [Swiss-Prot# Q8C0J2] |
Carrier-free (BSA/glycerol-free) ATG16L1 mouse monoclonal antibody,clone OTI5A2
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATG16L1 mouse monoclonal antibody,clone OTI2A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATG16L1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ATG16L1 |
ATG16L1 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
ATG16L1 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATG16L1 mouse monoclonal antibody,clone OTI5A2
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ATG16L1 mouse monoclonal antibody,clone OTI5A2, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ATG16L1 mouse monoclonal antibody,clone OTI5A2, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ATG16L1 mouse monoclonal antibody,clone OTI5A2
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATG16L1 mouse monoclonal antibody,clone OTI2A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ATG16L1 mouse monoclonal antibody,clone OTI2A10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ATG16L1 mouse monoclonal antibody,clone OTI2A10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ATG16L1 mouse monoclonal antibody,clone OTI2A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |