Antibodies

View as table Download

Rabbit Polyclonal Antibody against ATOH1 (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MATH1/HATH1/ATOH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 323-354 amino acids from the C-terminal region of human MATH1/HATH1/ATOH1.

Rabbit Polyclonal Antibody against ATOH1 (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MATH1/HATH1/ATOH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 78-109 amino acids from the N-terminal region of human MATH1/HATH1/ATOH1.

Rabbit Polyclonal Anti-ATOH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATOH1 antibody: synthetic peptide directed towards the middle region of human ATOH1. Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS

Rabbit Polyclonal Anti-Atoh1 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Atoh1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Atoh1. Synthetic peptide located within the following region: EEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDST

ATOH1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Unmodified