Germany
Japan
United Kingdom
China
ATP1A2 Antibody
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY |
Antibodies
View as table DownloadATP1A2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2 |
ATP1A2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2 |
ATP1A2 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- ATP1A2