Antibodies

Jump to Filters
View as table Download
ATP1B4 Rabbit Polyclonal Antibody
TA341890

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ATP1B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
ATP1B4 Rabbit Polyclonal Antibody
TA369544

USD 380.00

4 Weeks

ATP1B4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATP1B4