Antibodies

Jump to Filters
View as table Download
ATP5MC2 Rabbit Polyclonal Antibody
TA345698

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATP5G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA
ATP5MC2 Rabbit Polyclonal Antibody
TA313489

USD 345.00

In Stock

Rabbit polyclonal anti-ATP5G2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP5G2.