ATP6V1A mouse monoclonal antibody, clone 4F5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
ATP6V1A mouse monoclonal antibody, clone 4F5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
ATP6V1A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 447~477 amino acids from the Central region of human ATP6V1A |
Rabbit Polyclonal Anti-ATP6V1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A. Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR |
ATP6V1A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
ATP6V1A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |