Antibodies

View as table Download

B3GALT6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human B3GALT6

Rabbit Polyclonal Anti-B3GALT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the N terminal of human B3GALT6. Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS

Rabbit Polyclonal Anti-B3GALT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the C terminal of human B3GALT6. Synthetic peptide located within the following region: VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE