Antibodies

Jump to Filters
View as table Download
B3GNT4 Rabbit Polyclonal Antibody
TA346843

USD 475.00

5 Days

Rabbit Polyclonal Anti-B3GNT4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GNT4 antibody: synthetic peptide directed towards the N terminal of human B3GNT4. Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR
B3GNT4 (Center) Rabbit Polyclonal Antibody
AP50328PU-N

USD 450.00

2 Weeks

B3GNT4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 236-264 amino acids from the Central region of human B3GNT4
B3GNT4 Rabbit Polyclonal Antibody
TA373894

USD 220.00

3 Weeks

B3GNT4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-305 of human B3GNT4 (NP_110392.1).
Modifications Unmodified