Antibodies

View as table Download

B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2

Rabbit Polyclonal Anti-B3gat2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-B3gat2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV