B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2 |
B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2 |
Rabbit Polyclonal Anti-B3gat2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B3gat2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV |