Germany
Japan
United Kingdom
China
B3GAT3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human B3GAT3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-B3GAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY |
B3GAT3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human B3GAT3 |
B3GAT3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human B3GAT3 |
Active filters
Target Symbol
- B3GAT3