Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-B4GALT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the N terminal of human B4GALT3. Synthetic peptide located within the following region: PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE |
Rabbit Polyclonal Anti-B4GALT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the middle region of human B4GALT3. Synthetic peptide located within the following region: MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN |
Carrier-free (BSA/glycerol-free) B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
B4galt3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
B4GALT3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human B4GALT3 (NP_003770.1). |
| Modifications | Unmodified |
B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- B4GALT3