BACH2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BACH2 |
BACH2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BACH2 |
Rabbit Polyclonal Anti-BACH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BACH2 antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT |
Rabbit polyclonal anti-Bach2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Anti-Bach2 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the n-terminus region of the Bach2 protein. |
Rabbit Polyclonal Anti-BACH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BACH2 Antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: TSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY |
BACH2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 282-312 amino acids from the Central region of human BACH2 |
BACH2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BACH2 |