Antibodies

Jump to Filters
View as table Download
BAG3 Rabbit Polyclonal Antibody
TA314928

USD 345.00

In Stock

Rabbit polyclonal anti-BAG3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAG3.
BAG3 Rabbit Polyclonal Antibody
TA322772

USD 345.00

In Stock

Anti-BAG3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human BCL2-associated athanogene 3
BAG3 Rabbit Polyclonal Antibody
TA346589

USD 475.00

5 Days

Rabbit Polyclonal Anti-BAG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAG3 antibody: synthetic peptide directed towards the middle region of human BAG3. Synthetic peptide located within the following region: NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
BAG3 (C-term) Goat Polyclonal Antibody
AP23023PU-N

USD 440.00

2 Weeks

BAG3 (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from C-terminus of human BAG3
BAG3 Goat Polyclonal Antibody
TA326328

USD 375.00

5 Days

Goat Anti-BAG3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KNAGNAEDPHTE, from the internal region of the protein sequence according to NP_004272.2.
BAG3 Rabbit Polyclonal Antibody
TA337170

USD 479.00

5 Days

Rabbit Polyclonal BAG3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A recombinant protein fragment corresponding to the C-terminal 196 amino acids of human BAG-3. Bag-3; full length-gel=GST-RP; human
BAG3 Goat Polyclonal Antibody
TA311289

USD 375.00

5 Days

Goat Anti-BAG3 / BIS/ CAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SSMTDTPGNPAAP, from the C Terminus of the protein sequence according to NP_004272.2.
BAG3 Rabbit Polyclonal Antibody
TA322773

USD 345.00

4 Weeks

Anti-BAG3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human BCL2-associated athanogene 3
BAG3 Rabbit Polyclonal Antibody
TA373914

USD 410.00

3 Weeks

BAG3 Rabbit polyclonal Antibody

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified
BAG3 Rabbit Monoclonal Antibody [Clone ID: R05-6D5]
TA383800

USD 380.00

4 Weeks

BAG3 Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
BAG3 Rabbit Monoclonal Antibody [Clone ID: R09-2G3]
TA383801

USD 380.00

4 Weeks

BAG3 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated