Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BAG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAG3 antibody: synthetic peptide directed towards the middle region of human BAG3. Synthetic peptide located within the following region: NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS |
Goat Anti-BAG3 / BIS/ CAIR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SSMTDTPGNPAAP, from the C Terminus of the protein sequence according to NP_004272.2. |
BAG3 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 380-575 of human BAG3 (NP_004272.2). |
| Modifications | Unmodified |
BAG3 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
BAG3 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- BAG3