Antibodies

Jump to Filters
View as table Download
BANF1 Mouse Monoclonal Antibody [Clone ID: 3F10-4G12]
AM20964PU-N

USD 480.00

2 Weeks

BANF1 mouse monoclonal antibody, clone 3F10-4G12

Applications ELISA, IHC, WB
Reactivities Human
BANF1 Rabbit Polyclonal Antibody
TA306382

USD 430.00

5 Days

Rabbit Polyclonal BANF1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen BANF1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human BANF1.
BANF1 Rabbit Polyclonal Antibody
TA306383

USD 430.00

5 Days

Rabbit Polyclonal BANF1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BANF1 antibody was raised against a 19 amino acid peptide from near the amino terminus of human BANF1.
BANF1 Rabbit Polyclonal Antibody
TA338203

USD 375.00

5 Days

Rabbit Polyclonal Anti-BANF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BANF1 antibody is: synthetic peptide directed towards the middle region of Human BANF1. Synthetic peptide located within the following region: FDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF
BANF1 Rabbit Polyclonal Antibody
TA373925

USD 220.00

3 Weeks

BANF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (NP_001137457.1).
Modifications Unmodified