BANF1 mouse monoclonal antibody, clone 3F10-4G12
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
BANF1 mouse monoclonal antibody, clone 3F10-4G12
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal BANF1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | BANF1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human BANF1. |
Rabbit Polyclonal BANF1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | BANF1 antibody was raised against a 19 amino acid peptide from near the amino terminus of human BANF1. |
Rabbit Polyclonal Anti-BANF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BANF1 antibody is: synthetic peptide directed towards the middle region of Human BANF1. Synthetic peptide located within the following region: FDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF |
BANF1 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |