Rabbit Polyclonal Anti-BCAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAM antibody: synthetic peptide directed towards the C terminal of human BCAM. Synthetic peptide located within the following region: SALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLL |
Rabbit Polyclonal Anti-BCAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAM antibody: synthetic peptide directed towards the C terminal of human BCAM. Synthetic peptide located within the following region: ADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLT |
Rabbit Polyclonal Anti-BCAM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BCAM |
BCAM rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BCAM |
CD239/BCAM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 352-547 of human CD239/CD239/BCAM (NP_005572.2). |
| Modifications | Unmodified |
CD239/BCAM Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 352-547 of human CD239/CD239/BCAM (NP_005572.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China