Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BCKD Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCKD Antibody: A synthesized peptide derived from human BCKD |
Rabbit Polyclonal Antibody against BCKDK (Center)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This BCKDK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-151 amino acids from the Central region of human BCKDK. |
Rabbit Polyclonal Anti-BCKDK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCKDK antibody: synthetic peptide directed towards the N terminal of human BCKDK. Synthetic peptide located within the following region: CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD |
BCKDK rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BCKDK |
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Active filters
Target Symbol
- BCKDK