Antibodies

Jump to Filters
View as table Download
BEX4 Rabbit Polyclonal Antibody
TA331375

USD 375.00

5 Days

Rabbit Polyclonal Anti-BEX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BEX4 antibody is: synthetic peptide directed towards the N-terminal region of Human BEX4. Synthetic peptide located within the following region: PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR