Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 29 of 29 results

(reset)

BHMT Rabbit Polyclonal Antibody

TA346077

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BHMT Rabbit Polyclonal Antibody

TA346078

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT (391-402) Goat Polyclonal Antibody

AP22552PU-N

USD 440.00

2 Weeks

BHMT (391-402) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Hamster, Human, Monkey, Rat
Immunogen	Synthetic peptide from C-term of human BHMT

1 / 3

2 / 3

3 / 3

Previous Next

BHMT Rabbit Polyclonal Antibody

TA327003

USD 275.00

3 Weeks

Rabbit anti-BHMT Polyclonal Antibody

Applications	ICC/IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human BHMT

BHMT Rabbit Polyclonal Antibody

TA308186

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)

1 / 3

2 / 3

3 / 3

Previous Next

BHMT Rabbit Polyclonal Antibody

TA308187

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)

1 / 3

2 / 3

3 / 3

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: 3D6]

AM50001PU-N

USD 340.00

2 Weeks

BHMT mouse monoclonal antibody, clone 3D6, Purified

Applications	ELISA, WB
Reactivities	Human

BHMT Mouse Monoclonal Antibody [Clone ID: 3D6]

AM50001PU-S

USD 230.00

2 Weeks

BHMT mouse monoclonal antibody, clone 3D6, Purified

Applications	ELISA, WB
Reactivities	Human

BHMT Goat Polyclonal Antibody

TA302433

USD 375.00

5 Days

Goat Polyclonal Antibody against BHMT

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-EQQLKELFEKQK, from the C Terminus of the protein sequence according to NP_001704.1.

1 / 2

2 / 2

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI3E11]

CF500959

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI10B3]

CF500960

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI10B3 (formerly 10B3)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI1E5]

CF500961

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI2F6]

CF501049

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI3E11]

TA500959

USD 379.00

In Stock

Anti-BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

BHMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E11]

TA500959AM

USD 420.00

4 Weeks

Anti-BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

BHMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E11]

TA500959BM

USD 420.00

4 Weeks

Anti-BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI3E11]

TA500959S

USD 159.00

2 Days

Anti-BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI10B3]

TA500960

USD 379.00

In Stock

Anti-BHMT mouse monoclonal antibody, clone OTI10B3 (formerly 10B3)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B3]

TA500960AM

USD 420.00

4 Weeks

Anti-BHMT mouse monoclonal antibody, clone OTI10B3 (formerly 10B3), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10B3]

TA500960BM

USD 420.00

4 Weeks

Anti-BHMT mouse monoclonal antibody, clone OTI10B3 (formerly 10B3), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI10B3]

TA500960S

USD 159.00

2 Days

Anti-BHMT mouse monoclonal antibody, clone OTI10B3 (formerly 10B3)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI1E5]

TA500961

USD 379.00

In Stock

Anti-BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BHMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E5]

TA500961AM

USD 420.00

4 Weeks

Anti-BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BHMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E5]

TA500961BM

USD 420.00

4 Weeks

Anti-BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI1E5]

TA500961S

USD 159.00

2 Days

Anti-BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI2F6]

TA501049

USD 379.00

In Stock

BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]

TA501049AM

USD 420.00

4 Weeks

BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]

TA501049BM

USD 420.00

4 Weeks

BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BHMT Mouse Monoclonal Antibody [Clone ID: OTI2F6]

TA501049S

USD 159.00

2 Days

BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 29 of 29 results