Antibodies

View as table Download

BLK Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This BLK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BLK.

Goat Anti-BLK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QWSPLKVSAQDKD-C, from the N Terminus (near) of the protein sequence according to NP_001706.2.

Rabbit polyclonal BLK (Tyr501) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BLK around the phosphorylation site of tyrosine 501 (R-Q-YP-E-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-BLK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BLK antibody: synthetic peptide directed towards the middle region of human BLK. Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Mouse monoclonal Anti-BLK Clone BLK154/D4

Reactivities Human
Conjugation Unconjugated

Rabbit anti Blk Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to N-term of human Blk protein. This sequence is identical to mouse and rat.

Rabbit Polyclonal Anti-BLK Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BLK

BLK Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human BLK

BLK rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BLK

BLK Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified