Antibodies

Jump to Filters
View as table Download
BMI1 Mouse Monoclonal Antibody [Clone ID: LLBmi1-1]
TA309589

USD 424.00

In Stock

Mouse Monoclonal Bmi1 Antibody (LLBmi1-1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
BMI1 Rabbit Polyclonal Antibody
TA326773

USD 410.00

3 Weeks

Rabbit anti-BMI1 Polyclonal Antibody

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BMI1 Rabbit Polyclonal Antibody
TA301482

USD 424.00

In Stock

Rabbit Polyclonal Antibody against Bmi1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region (within residues 1-100) of the human Bmi1 protein. [Swiss-Prot# P35226]
BMI1 Rabbit Polyclonal Antibody
TA306298

USD 430.00

In Stock

Rabbit Polyclonal BMI-1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen BMI-1 antibody was raised against a peptide corresponding to 15 amino acids near the center of human BMI-1.
BMI1 Rabbit Polyclonal Antibody
TA325069

USD 512.00

5 Days

Rabbit polyclonal BMI1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BMI1 antibody is generated from rabbits immunized with BMI1 recombinant protein.
BMI1 Goat Polyclonal Antibody
TA319184

USD 530.00

5 Days

Goat polyclonal anti-BMI1 antibody

Applications IF, WB
Reactivities Human
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 252-264 of human Bmi1 protein.
BMI1 Rabbit Polyclonal Antibody
TA335718

USD 375.00

5 Days

Rabbit Polyclonal Anti-BMI1 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-PCGF4 Antibody: synthetic peptide directed towards the C terminal of human PCGF4. Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
BMI1 Rabbit Polyclonal Antibody
TA349640

USD 345.00

In Stock

Rabbit Polyclonal Anti-BMI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BMI1
Bmi1 Rabbit Polyclonal Antibody
TA355627

USD 360.00

5 Days

Bmi1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Bmi1 (COMMD3-BMI1) Rabbit Polyclonal Antibody
TA361877

USD 360.00

5 Days

BMI1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BMI1
BMI1 Rabbit Polyclonal Antibody
TA374024

USD 410.00

3 Weeks

Bmi1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified