BMP10 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP10 |
BMP10 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP10 |
Rabbit polyclonal anti-BMP10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BMP10. |
Rabbit Polyclonal Anti-Bmp10 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bmp10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV |
Rabbit polyclonal antibody to BMP10 (bone morphogenetic protein 10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 360 and 424 of BMP10 (Uniprot ID#O95393) |
Rabbit Polyclonal Anti-BMP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BMP10 antibody is: synthetic peptide directed towards the C-terminal region of Human BMP10. Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE |
BMP10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP10 |
BMP10 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-316 of human BMP10 (NP_055297.1). |
Modifications | Unmodified |