Germany
Japan
United Kingdom
China
BMP5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BMP5 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-BMP5 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG |
Rabbit polyclonal anti-BMP-5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human BMP-5 |
Rabbit polyclonal anti-BMP-5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 29 of human BMP-5 |
BMP5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BMP5 |
BMP5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BMP5 |
BMP5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- BMP5