Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit polyclonal anti-BMP-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human BMP-6 |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI1B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI4A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI8B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI6G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BMP6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BMP6 |
BMP6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BMP6 (NP_001709.1). |
| Modifications | Unmodified |
BMP6 mouse monoclonal antibody,clone OTI1B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BMP6 mouse monoclonal antibody,clone OTI1B11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI1B11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI1B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI4A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI4A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BMP6 mouse monoclonal antibody,clone OTI8B11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI8B11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI8B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI6G9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI6G9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- BMP6