Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-BMP8B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BMP8B. |
Antibodies
View as table Download
BMP8B mouse monoclonal antibody, clone AT13E6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BMP8B mouse monoclonal antibody, clone AT13E6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BMP8B rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-BMP8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP8B antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8B. Synthetic peptide located within the following region: CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL |
Active filters
Target Symbol
- BMP8B