Antibodies

View as table Download

Rabbit polyclonal anti-BMP8B antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BMP8B.

BMP8B mouse monoclonal antibody, clone AT13E6, Purified

Applications ELISA, WB
Reactivities Human

BMP8B mouse monoclonal antibody, clone AT13E6, Purified

Applications ELISA, WB
Reactivities Human

BMP8B rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human

Rabbit Polyclonal Anti-BMP8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP8B antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8B. Synthetic peptide located within the following region: CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL