Germany
Japan
United Kingdom
China
BNC1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BNC1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Bnc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI |
Rabbit Polyclonal BNC1 Antibody
| Applications | WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 330-380 of human Bnc 1 protein was used as the immunogen. |
BNC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human BNC1 |
Active filters
Target Symbol
- BNC1