Rabbit Polyclonal Anti-BOLL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BOLL antibody: synthetic peptide directed towards the N terminal of human BOLL. Synthetic peptide located within the following region: GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ |
BOULE (BOLL) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 22-51 amino acids from the N-terminal region of human BOLL |
Goat Anti-BOULE / BOLL Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPEPIKTVWSIHY, from the C Terminus of the protein sequence according to NP_932074.1; NP_149019.1. |
Carrier-free (BSA/glycerol-free) BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-BOLL Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Purified BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
Purified BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
